FLJ35848 polyclonal antibody
  • FLJ35848 polyclonal antibody

FLJ35848 polyclonal antibody

Ref: AB-PAB21886
FLJ35848 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FLJ35848.
Información adicional
Size 100 uL
Gene Name FLJ35848
Gene Alias MGC43301
Gene Description hypothetical protein FLJ35848
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq YCQENPSAFSSFDFSYSGAERIQSVNHIEGLTKPGEENLFKLVTDKKIKQPNGFCDNYSAQKYGIIENVNKHNFQAKPQSGHYDPEEGPKHLDGLSQNTYQDLLESQGHSNSHRTRGGDNSRVNRTQVSCFSNN
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FLJ35848.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 284071
Iso type IgG

Enviar uma mensagem


FLJ35848 polyclonal antibody

FLJ35848 polyclonal antibody