ECM1 polyclonal antibody
  • ECM1 polyclonal antibody

ECM1 polyclonal antibody

Ref: AB-PAB21885
ECM1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ECM1.
Información adicional
Size 100 uL
Gene Name ECM1
Gene Alias -
Gene Description extracellular matrix protein 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq EDTLDKYCDREYAVKTHHHLCCRHPPSPTRDECFARRAPYPNYDRDILTIDIGRVTPNLMGHLCGNQRVLTKHKHIPGLIHNMTARCCDLPFPEQACCAEEEKLTFINDLCGPRRNIWRDPALCCYLSPGDEQVNCFNINYLRNVALVS
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ECM1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 1893
Iso type IgG

Enviar uma mensagem


ECM1 polyclonal antibody

ECM1 polyclonal antibody