CXorf23 polyclonal antibody
  • CXorf23 polyclonal antibody

CXorf23 polyclonal antibody

Ref: AB-PAB21881
CXorf23 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CXorf23.
Información adicional
Size 100 uL
Gene Name CXorf23
Gene Alias -
Gene Description chromosome X open reading frame 23
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq VAVGRKSENFHPVFEHLDSTQNTENKPTGEFAQEIITIIHQVKANYFPSPGITLHERFSTMQDIHKADVNEIPLNSDPEIHRRIDMSLAELQSKQAVIYESEQTLIKIIDPNDLRHDIERRRKERLQNEDEHIFHIASAAERDDQN
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CXorf23.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 256643
Iso type IgG

Enviar uma mensagem


CXorf23 polyclonal antibody

CXorf23 polyclonal antibody