CDCA7L polyclonal antibody
  • CDCA7L polyclonal antibody

CDCA7L polyclonal antibody

Ref: AB-PAB21880
CDCA7L polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CDCA7L.
Información adicional
Size 100 uL
Gene Name CDCA7L
Gene Alias DKFZp762L0311|JPO2|R1|RAM2
Gene Description cell division cycle associated 7-like
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq VRFHSKYFTEELRRIFIEDTDSETEDFAGFTQSDLNGKTNPEVMVVESDLSDDGKASLVSEEEEDEEEDKATPRRSRSRRSSIGLRVAFQFPTKKLANKPDKNSSSEQLFSSARLQNEKKTILERKKDCRQVIQREDSTSESE
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CDCA7L.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55536
Iso type IgG

Enviar uma mensagem


CDCA7L polyclonal antibody

CDCA7L polyclonal antibody