SYDE2 polyclonal antibody
  • SYDE2 polyclonal antibody

SYDE2 polyclonal antibody

Ref: AB-PAB21874
SYDE2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SYDE2.
Información adicional
Size 100 uL
Gene Name SYDE2
Gene Alias FLJ13815|RP11-33E12.1
Gene Description synapse defective 1, Rho GTPase, homolog 2 (C. elegans)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq RSHLSISPVSLPKHQLSQSFLKSSKEYCTYVVCNATNSSLSKNCALDFNEENDADDEGEIWYNPIPEDDDLGISSALSFGEADSAVLKLPAVNLSMLS
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SYDE2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 84144
Iso type IgG

Enviar uma mensagem


SYDE2 polyclonal antibody

SYDE2 polyclonal antibody