TMPRSS11F polyclonal antibody
  • TMPRSS11F polyclonal antibody

TMPRSS11F polyclonal antibody

Ref: AB-PAB21857
TMPRSS11F polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TMPRSS11F.
Información adicional
Size 100 uL
Gene Name TMPRSS11F
Gene Alias FLJ16046
Gene Description transmembrane protease, serine 11F
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq NKDPTQWIATFGATITPPAVKRNVRKIILHENYHRETNENDIALVQLSTGVEFSNIVQRVCLPDSSIKLPPKTSVFVTGFGSIVDDGPIQNTLRQARVETISTDVCNRKDVYDG
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TMPRSS11F.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 389208
Iso type IgG

Enviar uma mensagem


TMPRSS11F polyclonal antibody

TMPRSS11F polyclonal antibody