PARP11 polyclonal antibody
  • PARP11 polyclonal antibody

PARP11 polyclonal antibody

Ref: AB-PAB21853
PARP11 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PARP11.
Información adicional
Size 100 uL
Gene Name PARP11
Gene Alias C12orf6|DKFZp779H0122
Gene Description poly (ADP-ribose) polymerase family, member 11
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq SISAFSYICENEAIPMPPHWENVNTQVPYQLIPLHNQTHEYNEVANLFGKTMDRNRIKRIQRIQNLDLWEFFCRK
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PARP11.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 57097
Iso type IgG

Enviar uma mensagem


PARP11 polyclonal antibody

PARP11 polyclonal antibody