RTP2 polyclonal antibody
  • RTP2 polyclonal antibody

RTP2 polyclonal antibody

Ref: AB-PAB21848
RTP2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RTP2.
Información adicional
Size 100 uL
Gene Name RTP2
Gene Alias MGC78665
Gene Description receptor (chemosensory) transporter protein 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq YRIHVASRPDSGPHRAEFCEACQEGIVHWKPSEKLLEEEVTTYTSEASKPRAQAGSGYNF
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RTP2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 344892
Iso type IgG

Enviar uma mensagem


RTP2 polyclonal antibody

RTP2 polyclonal antibody