MINPP1 polyclonal antibody
  • MINPP1 polyclonal antibody

MINPP1 polyclonal antibody

Ref: AB-PAB21844
MINPP1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MINPP1.
Información adicional
Size 100 uL
Gene Name MINPP1
Gene Alias DKFZp564L2016|HIPER1|MINPP2|MIPP
Gene Description multiple inositol polyphosphate histidine phosphatase, 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq LVALIRHGTRYPTVKQIRKLRQLHGLLQARGSRDGGASSTGSRDLGAALADWPLWYADWMDGQLVEKGRQDMRQLALRLASLFPALFSRENYGRLRLITSSKHRCMDSSAAFLQGLWQHYHPGL
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MINPP1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9562
Iso type IgG

Enviar uma mensagem


MINPP1 polyclonal antibody

MINPP1 polyclonal antibody