BNIP2 polyclonal antibody
  • BNIP2 polyclonal antibody

BNIP2 polyclonal antibody

Ref: AB-PAB21843
BNIP2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant BNIP2.
Información adicional
Size 100 uL
Gene Name BNIP2
Gene Alias BNIP-2|NIP2
Gene Description BCL2/adenovirus E1B 19kDa interacting protein 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq VELKEEWQDEDFPIPLPEDDSIEADILAITGPEDQPGSLEVNGNKVRKKLMAPDISLTLDPSDGSVLSDDLDESGEIDLDGLDTPSENSNEFEWEDDLPKPKTTEVIRKGSITEYTAAEEKEDGRRWRMFRIGEQDHRV
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human BNIP2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 663
Iso type IgG

Enviar uma mensagem


BNIP2 polyclonal antibody

BNIP2 polyclonal antibody