SPINK2 polyclonal antibody
  • SPINK2 polyclonal antibody

SPINK2 polyclonal antibody

Ref: AB-PAB21839
SPINK2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SPINK2.
Información adicional
Size 100 uL
Gene Name SPINK2
Gene Alias HUSI-II
Gene Description serine peptidase inhibitor, Kazal type 2 (acrosin-trypsin inhibitor)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq KYRTPNCSQYRLPGCPRHFNPVCGSDMSTYANECTLCMKIREGGHNIKIIRNGPC
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SPINK2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 6691
Iso type IgG

Enviar uma mensagem


SPINK2 polyclonal antibody

SPINK2 polyclonal antibody