SPACA1 polyclonal antibody
  • SPACA1 polyclonal antibody

SPACA1 polyclonal antibody

Ref: AB-PAB21830
SPACA1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SPACA1.
Información adicional
Size 100 uL
Gene Name SPACA1
Gene Alias MGC32952|SAMP32
Gene Description sperm acrosome associated 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq REVILTNGCPGGESKCVVRVEECRGPTDCGWGKPISESLESVRLACIHTSPLNRFKYMWKL
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SPACA1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 81833
Iso type IgG

Enviar uma mensagem


SPACA1 polyclonal antibody

SPACA1 polyclonal antibody