C9orf50 polyclonal antibody
  • C9orf50 polyclonal antibody

C9orf50 polyclonal antibody

Ref: AB-PAB21829
C9orf50 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C9orf50.
Información adicional
Size 100 uL
Gene Name C9orf50
Gene Alias FLJ35803
Gene Description chromosome 9 open reading frame 50
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq HSQFTTVRKANQPHGAQVPRLKAALTHNPSGEGSRPCRQRCPFRVRFADETLQDTTLRYWERRRSVQQSVIVNQKAALPVASERVFGSVGK
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C9orf50.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 375759
Iso type IgG

Enviar uma mensagem


C9orf50 polyclonal antibody

C9orf50 polyclonal antibody