ZNF804B polyclonal antibody
  • ZNF804B polyclonal antibody

ZNF804B polyclonal antibody

Ref: AB-PAB21827
ZNF804B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZNF804B.
Información adicional
Size 100 uL
Gene Name ZNF804B
Gene Alias FLJ32110
Gene Description zinc finger protein 804B
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq KEVNISPSHLESVLHNTISINSKILQDKHDSIDETLEDSIGIHASFSKSNIHLSDVDFTPTSREKETRNTLKNTLENCVNHPCQANASFSPPNIYNHSDARISECLDEFSSLEP
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZNF804B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 219578
Iso type IgG

Enviar uma mensagem


ZNF804B polyclonal antibody

ZNF804B polyclonal antibody