STARD10 polyclonal antibody
  • STARD10 polyclonal antibody

STARD10 polyclonal antibody

Ref: AB-PAB21821
STARD10 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant STARD10.
Información adicional
Size 100 uL
Gene Name STARD10
Gene Alias CGI-52|MGC14401|NY-CO-28|PCTP2|SDCCAG28
Gene Description StAR-related lipid transfer (START) domain containing 10
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq MECCDVPAETLYDVLHDIEYRKKWDSNVIETFDIARLTVNADVGYYSWRCPKPLKNRDVITLRSWLPMGADYIIMNYSVKHPKYPPRKDLVRAVSIQTGYL
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human STARD10.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 10809
Iso type IgG

Enviar uma mensagem


STARD10 polyclonal antibody

STARD10 polyclonal antibody