SNRNP40 polyclonal antibody
  • SNRNP40 polyclonal antibody

SNRNP40 polyclonal antibody

Ref: AB-PAB21803
SNRNP40 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SNRNP40.
Información adicional
Size 100 uL
Gene Name SNRNP40
Gene Alias 40K|FLJ41108|HPRP8BP|MGC1910|PRP8BP|PRPF8BP|RP11-490K7.3|SPF38|WDR57
Gene Description small nuclear ribonucleoprotein 40kDa (U5)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq QGNVHNFEKNLLRCSWSPDGSKIAAGSADRFVYVWDTTSRRILYKLPGHAGSINEVAFHPDEPIIISASSDKRLYMGEIQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SNRNP40.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9410
Iso type IgG

Enviar uma mensagem


SNRNP40 polyclonal antibody

SNRNP40 polyclonal antibody