RAB14 polyclonal antibody
  • RAB14 polyclonal antibody

RAB14 polyclonal antibody

Ref: AB-PAB21798
RAB14 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RAB14.
Información adicional
Size 100 uL
Gene Name RAB14
Gene Alias FBP|RAB-14
Gene Description RAB14, member RAS oncogene family
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq GQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEEAKQFAEENGLLFLEASAKTGENVEDAFLEAAKKIYQNIQDGSLDLNAAESGVQHKPSAPQGGRLTSEPQPQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RAB14.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 51552
Iso type IgG

Enviar uma mensagem


RAB14 polyclonal antibody

RAB14 polyclonal antibody