RAB3GAP2 polyclonal antibody
  • RAB3GAP2 polyclonal antibody

RAB3GAP2 polyclonal antibody

Ref: AB-PAB21794
RAB3GAP2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RAB3GAP2.
Información adicional
Size 100 uL
Gene Name RAB3GAP2
Gene Alias DKFZp434D245|FLJ14579|KIAA0839|RAB3-GAP150|RAB3GAP150|p150
Gene Description RAB3 GTPase activating protein subunit 2 (non-catalytic)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq TYEIPRHPGVTEQNEELSILYPAAIVTIDGFSLFQSLRACRNQVAKAAASGNENIQPPPLAYKKWGLQDIDTIIDHASVGIMTLSPFDQMKTA
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RAB3GAP2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 25782
Iso type IgG

Enviar uma mensagem


RAB3GAP2 polyclonal antibody

RAB3GAP2 polyclonal antibody