HNRNPR polyclonal antibody
  • HNRNPR polyclonal antibody

HNRNPR polyclonal antibody

Ref: AB-PAB21792
HNRNPR polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant HNRNPR.
Información adicional
Size 100 uL
Gene Name HNRNPR
Gene Alias FLJ25714|HNRPR|hnRNP-R
Gene Description heterogeneous nuclear ribonucleoprotein R
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq MANQVNGNAVQLKEEEEPMDTSSVTHTEHYKTLIEAGLPQKVAERLDEIFQT
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human HNRNPR.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 10236
Iso type IgG

Enviar uma mensagem


HNRNPR polyclonal antibody

HNRNPR polyclonal antibody