SYTL5 polyclonal antibody
  • SYTL5 polyclonal antibody

SYTL5 polyclonal antibody

Ref: AB-PAB21790
SYTL5 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SYTL5.
Información adicional
Size 100 uL
Gene Name SYTL5
Gene Alias slp5
Gene Description synaptotagmin-like 5
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq KQVNVLGTDVVRQSILRRSPAEEVQSQEQTRQDAEKSDTSPVAGKKASHDGPKRKGFLLSKFRSATRGEIITPKTDTGRSYSLDLDGQHFRSLKSPPGSDRGSTGSSDLNDQEP
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SYTL5.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 94122
Iso type IgG

Enviar uma mensagem


SYTL5 polyclonal antibody

SYTL5 polyclonal antibody