MRPL37 polyclonal antibody
  • MRPL37 polyclonal antibody

MRPL37 polyclonal antibody

Ref: AB-PAB21785
MRPL37 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MRPL37.
Información adicional
Size 100 uL
Gene Name MRPL37
Gene Alias L37mt|MGC878|MRP-L2|MRP-L37|MRPL2|RPML2
Gene Description mitochondrial ribosomal protein L37
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq TDGRVFHFLVFQLNTTDLDSNEGVKNLAWVDSDQLLYQHFWCLPVIKKRVVVEPVGPVGFKPETFRKFLALYLHGA
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MRPL37.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 51253
Iso type IgG

Enviar uma mensagem


MRPL37 polyclonal antibody

MRPL37 polyclonal antibody