SERAC1 polyclonal antibody
  • SERAC1 polyclonal antibody

SERAC1 polyclonal antibody

Ref: AB-PAB21776
SERAC1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SERAC1.
Información adicional
Size 100 uL
Gene Name SERAC1
Gene Alias FLJ14917|FLJ30544
Gene Description serine active site containing 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq KPMEDEDRYTTCWPKTWLAKDCPALRIISVEYDTSLSDWRARCPMERKSIAFRSNELLRKLRAAGVGDRPVVWISHSMGGLLVKKMLLEASTKPEMS
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SERAC1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 84947
Iso type IgG

Enviar uma mensagem


SERAC1 polyclonal antibody

SERAC1 polyclonal antibody