LOC388333 polyclonal antibody
  • LOC388333 polyclonal antibody

LOC388333 polyclonal antibody

Ref: AB-PAB21773
LOC388333 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LOC388333.
Información adicional
Size 100 uL
Gene Name LOC388333
Gene Alias -
Gene Description hypothetical LOC388333
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq KCLGEIMASGQARPPFEEESPQPSTTVRSPEVVVDDEVPGPSAPWIDPSPQPQSLGLKRKSEWSD
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LOC388333.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 388333
Iso type IgG

Enviar uma mensagem


LOC388333 polyclonal antibody

LOC388333 polyclonal antibody