GGH polyclonal antibody
  • GGH polyclonal antibody

GGH polyclonal antibody

Ref: AB-PAB21765
GGH polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant GGH.
Información adicional
Size 100 uL
Gene Name GGH
Gene Alias GH
Gene Description gamma-glutamyl hydrolase (conjugase, folylpolygammaglutamyl hydrolase)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq FDDGDYFPVWGTCLGFEELSLLISGECLLTATDTVDVAMPLNFTGGQLHSRMFQNFPTELLLSLAVEPLTANFHKWSLSVKNFTMNEKLKK
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human GGH.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 8836
Iso type IgG

Enviar uma mensagem


GGH polyclonal antibody

GGH polyclonal antibody