SLCO5A1 polyclonal antibody
  • SLCO5A1 polyclonal antibody

SLCO5A1 polyclonal antibody

Ref: AB-PAB21758
SLCO5A1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SLCO5A1.
Información adicional
Size 100 uL
Gene Name SLCO5A1
Gene Alias FLJ39560|OATP-J|OATP5A1|OATPRP4|SLC21A15
Gene Description solute carrier organic anion transporter family, member 5A1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SVDAVSDDDVLKEKSNNSEQADKKVSSMGFGKDVRDLPRAAVRILSNM
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SLCO5A1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 81796
Iso type IgG

Enviar uma mensagem


SLCO5A1 polyclonal antibody

SLCO5A1 polyclonal antibody