LETM2 polyclonal antibody
  • LETM2 polyclonal antibody

LETM2 polyclonal antibody

Ref: AB-PAB21756
LETM2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LETM2.
Información adicional
Size 100 uL
Gene Name LETM2
Gene Alias FLJ25409
Gene Description leucine zipper-EF-hand containing transmembrane protein 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq GLTEEQLRQQLTEWQDLHLKENVPPSLLLLSRTFYLIDVKPKPIEIPLSGEAPKTDILVELPTFTE
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LETM2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 137994
Iso type IgG

Enviar uma mensagem


LETM2 polyclonal antibody

LETM2 polyclonal antibody