ZNF114 polyclonal antibody
  • ZNF114 polyclonal antibody

ZNF114 polyclonal antibody

Ref: AB-PAB21753
ZNF114 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZNF114.
Información adicional
Size 100 uL
Gene Name ZNF114
Gene Alias MGC149700|MGC17986
Gene Description zinc finger protein 114
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LPKRTFPEANRVCLTSISSQHSTLREDWRCPKTEEPHRQGVNNVKPPAVAPEKDESPVSICEDHEMRNHSKPTC
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZNF114.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 163071
Iso type IgG

Enviar uma mensagem


ZNF114 polyclonal antibody

ZNF114 polyclonal antibody