COL22A1 polyclonal antibody
  • COL22A1 polyclonal antibody

COL22A1 polyclonal antibody

Ref: AB-PAB21752
COL22A1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant COL22A1.
Información adicional
Size 100 uL
Gene Name COL22A1
Gene Alias -
Gene Description collagen, type XXII, alpha 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LKEELEEIASEPKSAHVFHVSDFNAIDKIRGKLRRRLCENVLCPSVRVEGDRFKHTNGGTKEITGFDLMDLFSVKEILGKRENGAQSSYVRMG
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human COL22A1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 169044
Iso type IgG

Enviar uma mensagem


COL22A1 polyclonal antibody

COL22A1 polyclonal antibody