FBXO43 polyclonal antibody
  • FBXO43 polyclonal antibody

FBXO43 polyclonal antibody

Ref: AB-PAB21750
FBXO43 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FBXO43.
Información adicional
Size 100 uL
Gene Name FBXO43
Gene Alias EMI2|ERP1|Fbx43
Gene Description F-box protein 43
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq ITHDFSDSSLCINDENACPELLGSSVSGTTCGTDEDIFVTPISNLVANIRFNASQILSPSPEVRGSISTPEDSGFNSLSLEKSEDSLSDQEGS
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FBXO43.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 286151
Iso type IgG

Enviar uma mensagem


FBXO43 polyclonal antibody

FBXO43 polyclonal antibody