WDYHV1 polyclonal antibody
  • WDYHV1 polyclonal antibody

WDYHV1 polyclonal antibody

Ref: AB-PAB21749
WDYHV1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant WDYHV1.
Información adicional
Size 100 uL
Gene Name WDYHV1
Gene Alias C8orf32|FLJ10204
Gene Description WDYHV motif containing 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq YLKNFASDRSHMKDSSGNWREPPPPYPCIETGDSKMNLNDFISMDPKVGWGAVYTLSEFTHRFGSK
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human WDYHV1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55093
Iso type IgG

Enviar uma mensagem


WDYHV1 polyclonal antibody

WDYHV1 polyclonal antibody