KLHL14 polyclonal antibody
  • KLHL14 polyclonal antibody

KLHL14 polyclonal antibody

Ref: AB-PAB21746
KLHL14 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant KLHL14.
Información adicional
Size 100 uL
Gene Name KLHL14
Gene Alias -
Gene Description kelch-like 14 (Drosophila)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq IGGNHLKGFSHLDVMLVECYDPKGDQWNILQTPILEGRSGPGCAVLDDSIYLVGGYSWSMGAYKSSTICYCPEKGTWTELEGDVAEPLAGPACVTVILPSC
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human KLHL14.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 57565
Iso type IgG

Enviar uma mensagem


KLHL14 polyclonal antibody

KLHL14 polyclonal antibody