C8orf58 polyclonal antibody
  • C8orf58 polyclonal antibody

C8orf58 polyclonal antibody

Ref: AB-PAB21737
C8orf58 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C8orf58.
Información adicional
Size 100 uL
Gene Name C8orf58
Gene Alias FLJ34715
Gene Description chromosome 8 open reading frame 58
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq CIVPGVTSTYRRIPDAAHGCSSWERGDKFRGVGREALFLKLASRDSGVEMAVGDSPLAALPGLSQDSLDFESSGS
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C8orf58.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 541565
Iso type IgG

Enviar uma mensagem


C8orf58 polyclonal antibody

C8orf58 polyclonal antibody