SCARA5 polyclonal antibody
  • SCARA5 polyclonal antibody

SCARA5 polyclonal antibody

Ref: AB-PAB21734
SCARA5 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SCARA5.
Información adicional
Size 100 uL
Gene Name SCARA5
Gene Alias FLJ23907|MGC45780|Tesr
Gene Description scavenger receptor class A, member 5 (putative)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq PDDLKALTRNVNRLNESFRDLQLRLLQAPLQADLTEQVWKVQDALQNQSDSLLALAGAVQRLE
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SCARA5.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 286133
Iso type IgG

Enviar uma mensagem


SCARA5 polyclonal antibody

SCARA5 polyclonal antibody