SNTB1 polyclonal antibody
  • SNTB1 polyclonal antibody

SNTB1 polyclonal antibody

Ref: AB-PAB21733
SNTB1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SNTB1.
Información adicional
Size 100 uL
Gene Name SNTB1
Gene Alias 59-DAP|A1B|BSYN2|DAPA1B|FLJ22442|MGC111389|SNT2|SNT2B1|TIP-43
Gene Description syntrophin, beta 1 (dystrophin-associated protein A1, 59kDa, basic component 1)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq QGCHNSAELIAEISTACTYKNQECRLTIHYENGFSITTEPQEGAFPKTIIQSPYEKLKMSSDDG
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SNTB1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 6641
Iso type IgG

Enviar uma mensagem


SNTB1 polyclonal antibody

SNTB1 polyclonal antibody