CHADL polyclonal antibody
  • CHADL polyclonal antibody

CHADL polyclonal antibody

Ref: AB-PAB21731
CHADL polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CHADL.
Información adicional
Size 100 uL
Gene Name CHADL
Gene Alias SLRR4B
Gene Description chondroadherin-like
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq QRCPQACICDNSRRHVACRYQNLTEVPDAIPELTQRLDLQGNLLKVIPAAAFQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CHADL.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 150356
Iso type IgG

Enviar uma mensagem


CHADL polyclonal antibody

CHADL polyclonal antibody