SAMD12 polyclonal antibody
  • SAMD12 polyclonal antibody

SAMD12 polyclonal antibody

Ref: AB-PAB21726
SAMD12 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SAMD12.
Información adicional
Size 100 uL
Gene Name SAMD12
Gene Alias FLJ39458|MGC148139|MGC148140
Gene Description sterile alpha motif domain containing 12
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq LHCGLNPRGIDHPAHAEGIKLQIEGEGVESQSIKNKNFQKVPDQKGTPKRLQAEAETAKSATVKLSKPVALWTQQDVCKWLKKHCPNQYQIYSESF
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SAMD12.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 401474
Iso type IgG

Enviar uma mensagem


SAMD12 polyclonal antibody

SAMD12 polyclonal antibody