ZNF768 polyclonal antibody
  • ZNF768 polyclonal antibody

ZNF768 polyclonal antibody

Ref: AB-PAB21723
ZNF768 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZNF768.
Información adicional
Size 100 uL
Gene Name ZNF768
Gene Alias FLJ23436
Gene Description zinc finger protein 768
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SPEGYLRGNMSENEEEEISQQEGSGDYEVEEIPFGLEPQSPGFEPQSPEFEPQSPRFEPESPGFESRSPGLVPPSPEFAPRS
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZNF768.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 79724
Iso type IgG

Enviar uma mensagem


ZNF768 polyclonal antibody

ZNF768 polyclonal antibody