KLF17 polyclonal antibody
  • KLF17 polyclonal antibody

KLF17 polyclonal antibody

Ref: AB-PAB21722
KLF17 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant KLF17.
Información adicional
Size 100 uL
Gene Name KLF17
Gene Alias FLJ40160|ZNF393|Zfp393
Gene Description Kruppel-like factor 17
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq TVPSTEAQAVLPSMAQMLPPQDAHDLGMPPAESQSLLVLGSQDSLVSQPDSQEGPFLPEQPGPAPQTVEKNSRPQEGTG
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human KLF17.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 128209
Iso type IgG

Enviar uma mensagem


KLF17 polyclonal antibody

KLF17 polyclonal antibody