ZNF454 polyclonal antibody
  • ZNF454 polyclonal antibody

ZNF454 polyclonal antibody

Ref: AB-PAB21712
ZNF454 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZNF454.
Información adicional
Size 100 uL
Gene Name ZNF454
Gene Alias FLJ37444|MGC138481
Gene Description zinc finger protein 454
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq MPASKKSTVKAEIPEEELDQWTIKERFSSSSHWKCASLLEWQCGGQEISLQRVVLTHPNTPSQECDESGSTMSSSLHSAQSQGFQP
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZNF454.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 285676
Iso type IgG

Enviar uma mensagem


ZNF454 polyclonal antibody

ZNF454 polyclonal antibody