SGSM2 polyclonal antibody
  • SGSM2 polyclonal antibody

SGSM2 polyclonal antibody

Ref: AB-PAB21711
SGSM2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SGSM2.
Información adicional
Size 100 uL
Gene Name SGSM2
Gene Alias KIAA0397|RUTBC1
Gene Description small G protein signaling modulator 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq HRDSTISNDVFISVDDLEPPEPQDPEDSRPKPEQEAGPGTPGTAVVEQQHSVEFDSPDSGLPSSRNYSVA
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SGSM2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9905
Iso type IgG

Enviar uma mensagem


SGSM2 polyclonal antibody

SGSM2 polyclonal antibody