MRPL41 polyclonal antibody
  • MRPL41 polyclonal antibody

MRPL41 polyclonal antibody

Ref: AB-PAB21710
MRPL41 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MRPL41.
Información adicional
Size 100 uL
Gene Name MRPL41
Gene Alias BMRP|MRP-L27|MRPL27|PIG3|RPML27
Gene Description mitochondrial ribosomal protein L41
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq KPYVSYLAPESEETPLTAAQLFSEAVAPAIEKDFKDGTFDPDNLEKYGFEPTQEGKLFQLYPRNFLR
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MRPL41.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 64975
Iso type IgG

Enviar uma mensagem


MRPL41 polyclonal antibody

MRPL41 polyclonal antibody