TDRD7 polyclonal antibody
  • TDRD7 polyclonal antibody

TDRD7 polyclonal antibody

Ref: AB-PAB21707
TDRD7 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TDRD7.
Información adicional
Size 100 uL
Gene Name TDRD7
Gene Alias KIAA1529|PCTAIRE2BP|RP11-508D10.1|TRAP
Gene Description tudor domain containing 7
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LNCSDCSIKVTKVDETRGIAHVYLFTPKNFPDPHRSINRQITNADLWKHQKDVFLSAISSGADSPNSKNGNMPMSGNTGENFRKNLTDVIKKSMVDHTSAFSTEELPPPV
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TDRD7.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23424
Iso type IgG

Enviar uma mensagem


TDRD7 polyclonal antibody

TDRD7 polyclonal antibody