ZNF770 polyclonal antibody
  • ZNF770 polyclonal antibody

ZNF770 polyclonal antibody

Ref: AB-PAB21706
ZNF770 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZNF770.
Información adicional
Size 100 uL
Gene Name ZNF770
Gene Alias FLJ20582|PRO1914
Gene Description zinc finger protein 770
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SPYASLCQVEFGNFNNLSNHSGNNVNYNASQQCQAPGVQKYEVSESDQMSGVKAESQDFIPGSTGQPCLPNVLLESEQSNPFCSYSEHQE
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZNF770.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 54989
Iso type IgG

Enviar uma mensagem


ZNF770 polyclonal antibody

ZNF770 polyclonal antibody