KLHL6 polyclonal antibody
  • KLHL6 polyclonal antibody

KLHL6 polyclonal antibody

Ref: AB-PAB21705
KLHL6 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant KLHL6.
Información adicional
Size 100 uL
Gene Name KLHL6
Gene Alias FLJ00029
Gene Description kelch-like 6 (Drosophila)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq GDVVEKSLEGPLAPSTDEPSQKTGDLVEILNGEKVKFDDAGLSLILQNGLETLRMENALTDVILCVDIQEFSCHRVVLAAASNYFRAM
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human KLHL6.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 89857
Iso type IgG

Enviar uma mensagem


KLHL6 polyclonal antibody

KLHL6 polyclonal antibody