FAM83H polyclonal antibody
  • FAM83H polyclonal antibody

FAM83H polyclonal antibody

Ref: AB-PAB21704
FAM83H polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FAM83H.
Información adicional
Size 100 uL
Gene Name FAM83H
Gene Alias AI3|FLJ46072
Gene Description family with sequence similarity 83, member H
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq SDKDKCSAIFRSDSLGTQGRLSRTLPASAEERDRLLRRMESMRKEKRVYSRFEVFCKKEEASSPGAGEGPAEEGTRDSKVGKFVPKILGTF
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FAM83H.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 286077
Iso type IgG

Enviar uma mensagem


FAM83H polyclonal antibody

FAM83H polyclonal antibody