BICD2 polyclonal antibody
  • BICD2 polyclonal antibody

BICD2 polyclonal antibody

Ref: AB-PAB21698
BICD2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant BICD2.
Información adicional
Size 100 uL
Gene Name BICD2
Gene Alias KIAA0699|bA526D8.1
Gene Description bicaudal D homolog 2 (Drosophila)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq EQKNSLRKELSHYMSINDSFYTSHLHVSLDGLKFSDDAAEPNNDAEALVNGFEHGGLAKLPLDNKTSTPKKEGLAPPSPSLVSDLLSELNISE
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human BICD2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23299
Iso type IgG

Enviar uma mensagem


BICD2 polyclonal antibody

BICD2 polyclonal antibody