SLFN12L polyclonal antibody
  • SLFN12L polyclonal antibody

SLFN12L polyclonal antibody

Ref: AB-PAB21696
SLFN12L polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SLFN12L.
Información adicional
Size 100 uL
Gene Name SLFN12L
Gene Alias FLJ23922
Gene Description schlafen family member 12-like
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq NRVKQLTEKEWIQFMVDSEPVCEELPSPASTSSPVSQSYPLREYINFKIQPLRYHLPGLSEKITCAPKTFCRNLFSQHEGLK
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SLFN12L.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 100506736
Iso type IgG

Enviar uma mensagem


SLFN12L polyclonal antibody

SLFN12L polyclonal antibody