TSR1 polyclonal antibody
  • TSR1 polyclonal antibody

TSR1 polyclonal antibody

Ref: AB-PAB21695
TSR1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TSR1.
Información adicional
Size 100 uL
Gene Name TSR1
Gene Alias FLJ10534|KIAA1401|MGC131829
Gene Description TSR1, 20S rRNA accumulation, homolog (S. cerevisiae)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq EKYKQERLEEMFPDEVDTPRDVAARIRFQKYRGLKSFRTSPWDPKENLPQDYARIFQFQNFTNTRKSIFKEVEEKEVEGAEVGWYVTLHVSEVPVSVVECFRQGTPLIAFSLLPHEQKMSVLNMVVRRDPGNTEPVKAKE
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TSR1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55720
Iso type IgG

Enviar uma mensagem


TSR1 polyclonal antibody

TSR1 polyclonal antibody