TSR1 polyclonal antibody View larger

Rabbit polyclonal antibody raised against recombinant TSR1.

AB-PAB21695

New product

TSR1 polyclonal antibody

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 6 pontos de fidelização. Seu carrinho totalizará 6 pontos de fidelização que podem ser convertidos num vale de desconto de 24.00EUR.


Data sheet

Size 100 uL
Gene Name TSR1
Gene Alias FLJ10534|KIAA1401|MGC131829
Gene Description TSR1, 20S rRNA accumulation, homolog (S. cerevisiae)
Storage Conditions Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq EKYKQERLEEMFPDEVDTPRDVAARIRFQKYRGLKSFRTSPWDPKENLPQDYARIFQFQNFTNTRKSIFKEVEEKEVEGAEVGWYVTLHVSEVPVSVVECFRQGTPLIAFSLLPHEQKMSVLNMVVRRDPGNTEPVKAKE
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)<br>The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TSR1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55720
Iso type IgG

More info

Rabbit polyclonal antibody raised against recombinant TSR1.

Enviar uma mensagem

Rabbit polyclonal antibody raised against recombinant TSR1.

Rabbit polyclonal antibody raised against recombinant TSR1.