TMEM102 polyclonal antibody
  • TMEM102 polyclonal antibody

TMEM102 polyclonal antibody

Ref: AB-PAB21694
TMEM102 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TMEM102.
Información adicional
Size 100 uL
Gene Name TMEM102
Gene Alias CBAP|FLJ36878
Gene Description transmembrane protein 102
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq HAPLGPYARGPHYDAGFTLLVPMFSLDGTELQLDLESCYAQVCLPEMVCGTPIREMWQDCLGPPVPGARDSIHRTESEESSKDWQSSVDQPHSYVTEHE
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TMEM102.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 284114
Iso type IgG

Enviar uma mensagem


TMEM102 polyclonal antibody

TMEM102 polyclonal antibody