C16orf58 polyclonal antibody
  • C16orf58 polyclonal antibody

C16orf58 polyclonal antibody

Ref: AB-PAB21690
C16orf58 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C16orf58.
Información adicional
Size 100 uL
Gene Name C16orf58
Gene Alias FLJ13868
Gene Description chromosome 16 open reading frame 58
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq RALVMETLNEGRLRLVLKHYLQRGEVLDPTAANRMEPLWTGFWPAPSLSLGVPLHRLVSSVFELQQLVEGHQESYLLCWDQSQNQVQVVLNQKAGPKTILRA
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C16orf58.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 64755
Iso type IgG

Enviar uma mensagem


C16orf58 polyclonal antibody

C16orf58 polyclonal antibody